PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_1AL_1B5F51626.1
Common NameWM14
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MIKC_MADS
Protein Properties Length: 208aa    MW: 24331.9 Da    PI: 9.655
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_1AL_1B5F51626.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF824e-26958150
                           S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
                 SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                           krien+snrqvtf+kRr+g+ KKA E+ vLCdaev v+ifss gkly++ 
  Traes_1AL_1B5F51626.1  9 KRIENSSNRQVTFAKRRAGLVKKAREIGVLCDAEVGVVIFSSAGKLYDFW 58
                           79*********************************************995 PP

2K-box65.22.3e-2271163193
                  K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelq 88 
                            yq++sgk l+++k++s + e++++kke++n+q e+Rh++Ged++sL+ keL  +e++L ++ ++ R+k +++++++ ++ ++ e+e++
  Traes_1AL_1B5F51626.1  71 YQTNSGKILWDEKHKSISAEIDRVKKENDNMQIELRHMKGEDVNSLQPKELIAIEEALTNGQTNLRDKMMDHWKMHRRNEKMLEEEHK 158
                            89999999************************************************************99999999988888888877 PP

                  K-box  89 eenka 93 
                                +
  Traes_1AL_1B5F51626.1 159 LLALR 163
                            65555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.1E-38160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.441161IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.92E-31295IPR002100Transcription factor, MADS-box
CDDcd002652.39E-39280No hitNo description
PRINTSPR004041.6E-27323IPR002100Transcription factor, MADS-box
PfamPF003193.7E-241057IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-273859IPR002100Transcription factor, MADS-box
PfamPF014865.6E-1582164IPR002487Transcription factor, K-box
PROSITE profilePS5129712.08784170IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010093Biological Processspecification of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 208 aa     Download sequence    Send to blast
MGRGKIEIKR IENSSNRQVT FAKRRAGLVK KAREIGVLCD AEVGVVIFSS AGKLYDFWTP  60
KTTLPRILEK YQTNSGKILW DEKHKSISAE IDRVKKENDN MQIELRHMKG EDVNSLQPKE  120
LIAIEEALTN GQTNLRDKMM DHWKMHRRNE KMLEEEHKLL ALRMHQQDDL SSGMREMELG  180
YHQGRDFTSQ MPFTFRLQPS HPNLQEDK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P8e-19171169Myocyte-specific enhancer factor 2B
1tqe_Q8e-19171169Myocyte-specific enhancer factor 2B
1tqe_R8e-19171169Myocyte-specific enhancer factor 2B
1tqe_S8e-19171169Myocyte-specific enhancer factor 2B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00080ChIP-seqTransfer from AT5G20240Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM5028800.0AM502880.1 Triticum aestivum mRNA for MIKC-type MADS-box transcription factor WM14 (WM14 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003568421.11e-139PREDICTED: MADS-box transcription factor 4-like isoform X1
SwissprotQ407031e-130MADS4_ORYSJ; MADS-box transcription factor 4
TrEMBLA9J1Y71e-155A9J1Y7_WHEAT; MIKC-type MADS-box transcription factor WM14
STRINGMLOC_44514.11e-152(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP34343877
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G20240.15e-73MIKC_MADS family protein
Publications ? help Back to Top
  1. Paolacci AR,Tanzarella OA,Porceddu E,Varotto S,Ciaffi M
    Molecular and phylogenetic analysis of MADS-box genes of MIKC type and chromosome location of SEP-like genes in wheat (Triticum aestivum L.).
    Mol. Genet. Genomics, 2007. 278(6): p. 689-708
    [PMID:17846794]
  2. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]